PDB entry 1ff1

View 1ff1 on RCSB PDB site
Description: structure of the second eps15 homology domain of human eps15 in complex with ptgssstnpfl
Class: signaling protein
Keywords: complex, eh domain, npf, hrb, calcium binding, signaling domain, ef-hand, signaling protein
Deposited on 2000-07-24, released 2000-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: epidermal growth factor receptor substrate 15
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P42566 (0-94)
  Domains in SCOPe 2.08: d1ff1a_
• Chain 'B':
  Compound: ptgssstnpfl peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1FF1 (Start-10)
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ff1A (A:)
  pwavkpedkakydaifdslspvngflsgdkvkpvllnsklpvdilgrvwelsdidhdgml
  drdefavamflvycalekepvpmslppalvppskr
  

  
  
• Chain 'B':
  No sequence available.