PDB entry 1fev

View 1fev on RCSB PDB site
Description: crystal structure of the ala4aib mutation in RNAse s
Class: hydrolase
Keywords: alpha aminoisobutyric acid, AIB, HYDROLASE
Deposited on 2000-07-23, released 2000-08-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-14)
      • modified residue (3)
      • engineered (12)
    Domains in SCOPe 2.05: d1fev.1
  • Chain 'B':
    Compound: s protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1fev.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fevA (A:)
    ketaaakferqhlds
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fevB (B:)
    nycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystmsitd
    cretgsskypncaykttqankhiivacegnpyvpvhfdasv