PDB entry 1fev

View 1fev on RCSB PDB site
Description: crystal structure of the ala4aib mutation in RNAse s
Class: hydrolase
Keywords: alpha aminoisobutyric acid, AIB, HYDROLASE
Deposited on 2000-07-23, released 2000-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: s peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-14)
    • modified residue (3)
    • engineered (12)
  Domains in SCOPe 2.08: d1fev.1
• Chain 'B':
  Compound: s protein
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-100)
  Domains in SCOPe 2.08: d1fev.1
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fevA (A:)
  ketaaakferqhlds
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fevB (B:)
  nycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystmsitd
  cretgsskypncaykttqankhiivacegnpyvpvhfdasv