PDB entry 1fes

View 1fes on RCSB PDB site
Description: solution structure of the apo form of the yeast metallochaperone, atx1
Deposited on 2000-07-22, released 2001-03-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-14, with a file datestamp of 2001-03-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fesa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fesA (A:)
    maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki
    kktgkevrsgkql