PDB entry 1fer

View 1fer on RCSB PDB site
Description: structure at ph 6.5 of ferredoxin I from azotobacter vinelandii at 2.3 angstroms resolution
Class: electron transfer(iron-sulfur protein)
Keywords: electron transfer(iron-sulfur protein)
Deposited on 1992-09-02, released 1993-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin I
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fera_
  • Heterogens: F3S, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ferA (A:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler