PDB entry 1fer

View 1fer on RCSB PDB site
Description: structure at ph 6.5 of ferredoxin I from azotobacter vinelandii at 2.3 angstroms resolution
Class: electron transfer(iron-sulfur protein)
Keywords: electron transfer(iron-sulfur protein)
Deposited on 1992-09-02, released 1993-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.17
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin I
  Species: Azotobacter vinelandii [TaxId:354]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00214 (0-105)
  Domains in SCOPe 2.08: d1fera_
• Heterogens: F3S, SF4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ferA (A:)
  afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
  pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler