PDB entry 1fej

View 1fej on RCSB PDB site
Description: structural implications of drug resistant mutants of hiv-1 protease: high resolution crystal structures of the mutant protease/substrate analog complexes
Deposited on 2000-07-21, released 2001-06-01
The last revision prior to the SCOP 1.67 freeze date was dated 2001-06-01, with a file datestamp of 2001-06-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.215
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.67: d1fejc_
  • Chain 'D':
    Domains in SCOP 1.67: d1fejd_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fejC (C:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlmtqigatlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fejD (D:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlmtqigatlnf