PDB entry 1feh

View 1feh on RCSB PDB site
Description: fe-only hydrogenase from clostridium pasteurianum
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1998-10-28, released 1999-01-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (periplasmic hydrogenase 1)
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1feha1, d1feha2, d1feha3
  • Heterogens: HC1, SF4, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fehA (A:)
    mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
    acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
    skpflpkdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigae
    dekcfddtncllcgqciiacpvaalsekshmdrvknalnapekhvivamapsvrasigel
    fnmgfgvdvtgkiytalrqlgfdkifdinfgadmtimeeatelvqrienngpfpmftscc
    pgwvrqaenyypellnnlssakspqqifgtasktyypsisgldpknvftvtvmpctskkf
    eadrpqmekdglrdidavittrelakmikdakipfakledseadpamgeysgagaifgat
    ggvmeaalrsakdfaenaeledieykqvrglngikeaeveinnnkynvavingasnlfkf
    mksgminekqyhfievmachggcvngggqphvnpkdlekvdikkvrasvlynqdehlskr
    kshentalvkmyqnyfgkpgegraheilhfkykk