PDB entry 1fee

View 1fee on RCSB PDB site
Description: crystal structure of copper-hah1
Deposited on 2000-07-21, released 2001-01-21
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-21, with a file datestamp of 2001-01-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1feea_
  • Chain 'B':
    Domains in SCOP 1.55: d1feeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1feeA (A:)
    pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
    vsylgle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1feeB (B:)
    mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
    tvsylgl