PDB entry 1fe8

View 1fe8 on RCSB PDB site
Description: crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
Deposited on 2000-07-21, released 2001-04-04
The last revision prior to the SCOP 1.65 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.227
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fe8A (A:)
    gshmapdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsi
    ttidvpwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvi
    lvtdvsvdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlp
    tmvtlgnsflhklcsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fe8A (A:)
    pdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidv
    pwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdv
    svdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtl
    gnsflhklcs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fe8B (B:)
    gshmapdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsi
    ttidvpwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvi
    lvtdvsvdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlp
    tmvtlgnsflhklcsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fe8B (B:)
    pdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittidv
    pwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtdv
    svdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvtl
    gnsflhklcs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fe8C (C:)
    gshmapdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsi
    ttidvpwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvi
    lvtdvsvdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlp
    tmvtlgnsflhklcsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fe8C (C:)
    apdcsqpldvillldgsssfpasyfdemksfakafiskanigprltqvsvlqygsittid
    vpwnvvpekahllslvdvmqreggpsqigdalgfavryltsemhgarpgaskavvilvtd
    vsvdsvdaaadaarsnrvtvfpigigdrydaaqlrilagpagdsnvvklqriedlptmvt
    lgnsflhklcs
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fe8H (H:)
    dvklvqsgpglvapsqslsitctvsgfslttygvswvrqppgkglewlgviwgdgnttyh
    salisrlsiskdnsrsqvflklnslhtddtatyycagnyygmdywgqgtsvtvssaetta
    psvyklepvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtvt
    sstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fe8I (I:)
    dvklvqsgpglvapsqslsitctvsgfslttygvswvrqppgkglewlgviwgdgnttyh
    salisrlsiskdnsrsqvflklnslhtddtatyycagnyygmdywgqgtsvtvssaetta
    psvyklepvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtvt
    sstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fe8J (J:)
    dvklvqsgpglvapsqslsitctvsgfslttygvswvrqppgkglewlgviwgdgnttyh
    salisrlsiskdnsrsqvflklnslhtddtatyycagnyygmdywgqgtsvtvssaetta
    psvyklepvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtvt
    sstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fe8L (L:)
    diamtqttsslsaslgqkvtiscrasqdignylnwyqqkpdgtvrlliyytsrlhsgvps
    rfsgsgsgtdysltisnlesediatyfcqnggtnpwtfgggtklevkradaapttsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fe8M (M:)
    diamtqttsslsaslgqkvtiscrasqdignylnwyqqkpdgtvrlliyytsrlhsgvps
    rfsgsgsgtdysltisnlesediatyfcqnggtnpwtfgggtklevkradaapttsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fe8N (N:)
    diamtqttsslsaslgqkvtiscrasqdignylnwyqqkpdgtvrlliyytsrlhsgvps
    rfsgsgsgtdysltisnlesediatyfcqnggtnpwtfgggtklevkradaapttsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr