PDB entry 1fe7

View 1fe7 on RCSB PDB site
Description: first structural evidence of anti-inflammatory action of vitamin e (2,5,7,8-tetramethyl-2-(4',8',12'-trimethyltridecyl)-6-chromanol) through its binding to phospholipase a2 specifically: crystal structure of a complex formed between phospholipase a2 and vitamin e at 1.80 resolution
Class: toxin
Keywords: Structure, Phospholipase A2, Daboia Russelli Pulchella, Neurotoxic, alpha-tocopherol, inflammation
Deposited on 2000-07-21, released 2001-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2002-07-10, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russelli pulchella
    Database cross-references and differences (RAF-indexed):
    • GB AAB47213 (0-48)
    Domains in SCOPe 2.06: d1fe7a_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Daboia russelli pulchella
    Database cross-references and differences (RAF-indexed):
    • GB AAB47213 (0-48)
    Domains in SCOPe 2.06: d1fe7b_
  • Heterogens: CO3, VIT, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fe7A (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fe7B (B:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c