PDB entry 1fe7
View 1fe7 on RCSB PDB site
Description: first structural evidence of anti-inflammatory action of vitamin e (2,5,7,8-tetramethyl-2-(4',8',12'-trimethyltridecyl)-6-chromanol) through its binding to phospholipase a2 specifically: crystal structure of a complex formed between phospholipase a2 and vitamin e at 1.80 resolution
Class: toxin
Keywords: Structure, Phospholipase A2, Daboia Russelli Pulchella, Neurotoxic, alpha-tocopherol, inflammation
Deposited on
2000-07-21, released
2001-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated
2002-07-10, with a file datestamp of
2007-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: phospholipase a2
Species: Daboia russelli pulchella
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1fe7a_ - Chain 'B':
Compound: phospholipase a2
Species: Daboia russelli pulchella
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1fe7b_ - Heterogens: CO3, VIT, ACY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1fe7A (A:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1fe7B (B:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c