PDB entry 1fe5

View 1fe5 on RCSB PDB site
Description: sequence and crystal structure of a basic phospholipase a2 from common krait (bungarus caeruleus) at 2.4 resolution: identification and characterization of its pharmacological sites.
Deposited on 2000-07-21, released 2001-01-24
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1fe5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fe5A (A:)
  nliqfknmiqcagtrpwtayvnygcycgkggsgtpvdeldrccythdncyneaekipgcn
  pniktysytctepnltctdtadtcarflcncdrtaaicfasapynsnnvmissstncq