PDB entry 1fe5

View 1fe5 on RCSB PDB site
Description: sequence and crystal structure of a basic phospholipase a2 from common krait (bungarus caeruleus) at 2.4 resolution: identification and characterization of its pharmacological sites.
Class: toxin
Keywords: Bungarus caeruleus; phospholipase A2 (PLA2); presynaptic neurotoxin; neurotoxic site; X-ray structure; molecular replacement, TOXIN
Deposited on 2000-07-21, released 2001-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Bungarus caeruleus [TaxId:132961]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DF52 (0-117)
  Domains in SCOPe 2.08: d1fe5a_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fe5A (A:)
  nliqfknmiqcagtrpwtayvnygcycgkggsgtpvdeldrccythdncyneaekipgcn
  pniktysytctepnltctdtadtcarflcncdrtaaicfasapynsnnvmissstncq