PDB entry 1fe4

View 1fe4 on RCSB PDB site
Description: crystal structure of mercury-hah1
Class: metal transport
Keywords: beta-alpha-beta-beta-alpha-beta, METAL TRANSPORT
Deposited on 2000-07-20, released 2001-01-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.204
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: copper transport protein atox1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00244 (0-67)
  Domains in SCOPe 2.05: d1fe4a_
• Chain 'B':
  Compound: copper transport protein atox1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00244 (0-67)
  Domains in SCOPe 2.05: d1fe4b_
• Heterogens: SUC, IUM, SO4, HG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fe4A (A:)
  mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
  tvsylgle
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fe4B (B:)
  mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
  tvsylgle