PDB entry 1fe4

View 1fe4 on RCSB PDB site
Description: crystal structure of mercury-hah1
Deposited on 2000-07-20, released 2001-01-24
The last revision prior to the SCOP 1.67 freeze date was dated 2001-01-24, with a file datestamp of 2001-01-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.204
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1fe4a_
  • Chain 'B':
    Domains in SCOP 1.67: d1fe4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fe4A (A:)
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fe4B (B:)
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle