PDB entry 1fe0

View 1fe0 on RCSB PDB site
Description: crystal structure of cadmium-hah1
Deposited on 2000-07-20, released 2001-01-20
The last revision prior to the SCOP 1.59 freeze date was dated 2001-01-20, with a file datestamp of 2001-01-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fe0a_
  • Chain 'B':
    Domains in SCOP 1.59: d1fe0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fe0A (A:)
    pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
    vsylgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fe0B (B:)
    mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
    tvsylgle