PDB entry 1fe0

View 1fe0 on RCSB PDB site
Description: crystal structure of cadmium-hah1
Class: metal transport
Keywords: beta-alpha-beta-beta-alpha-beta, METAL TRANSPORT
Deposited on 2000-07-20, released 2001-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper transport protein atox1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fe0a_
  • Chain 'B':
    Compound: copper transport protein atox1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fe0b_
  • Heterogens: SO4, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1fe0A (A:)
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle

    Sequence, based on observed residues (ATOM records): (download) 
    >1fe0A (A:)
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fe0B (B:)
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle