PDB entry 1fdx

View 1fdx on RCSB PDB site
Description: structure of peptococcus aerogenes ferredoxin, refinement at 2 angstroms resolution
Deposited on 1976-08-01, released 1976-08-04
The last revision was dated 2000-03-29, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: F4S

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1fdx_ (-)
    ayvindsciacgackpecpvniiqgsiyaidadscidcgscasvcpvgapnped
    

  • Chain 'p':
    No sequence available.