PDB entry 1fdu

View 1fdu on RCSB PDB site
Description: human 17-beta-hydroxysteroid-dehydrogenase type 1 mutant h221l complexed with estradiol and nadp+
Class: dehydrogenase
Keywords: dehydrogenase, 17-beta-hydroxysteroid, mutant, estradiol, nadp
Deposited on 1998-01-14, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17-beta-hydroxysteroid dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14061 (0-End)
      • engineered (220)
    Domains in SCOPe 2.07: d1fdua_
  • Chain 'B':
    Compound: 17-beta-hydroxysteroid dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14061 (0-End)
      • engineered (220)
    Domains in SCOPe 2.07: d1fdub_
  • Chain 'C':
    Compound: 17-beta-hydroxysteroid dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14061 (0-End)
      • engineered (220)
    Domains in SCOPe 2.07: d1fduc_
  • Chain 'D':
    Compound: 17-beta-hydroxysteroid dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14061 (0-End)
      • engineered (220)
    Domains in SCOPe 2.07: d1fdud_
  • Heterogens: SO4, EST, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fduA (A:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylalskqvfreaaqnpeevaevf
    ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfgdvpakaeagaeaggg
    rgpgaedeagrsavgdpelgdppaapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fduA (A:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlgvldrtdihtfhrfyqylalskqvfreaaqnpeevaevfltal
    rapkptlryftterflpllrmrlddpsgsnyvtamhrevfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fduB (B:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylalskqvfreaaqnpeevaevf
    ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfgdvpakaeagaeaggg
    rgpgaedeagrsavgdpelgdppaapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fduB (B:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlvldrtdihtfhrfyqylalskqvfreaaqnpeevaevfltalr
    apkptlryftterflpllrmrlddpsgsnyvtamhrevfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fduC (C:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylalskqvfreaaqnpeevaevf
    ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfgdvpakaeagaeaggg
    rgpgaedeagrsavgdpelgdppaapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fduC (C:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylalskqvfreaaqnpeevaevf
    ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fduD (D:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylalskqvfreaaqnpeevaevf
    ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfgdvpakaeagaeaggg
    rgpgaedeagrsavgdpelgdppaapq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fduD (D:)
    artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
    tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
    mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
    sliecgpvhtafmekvlevldrtdihtfhrfyqylalskqvfreaaqnpeevaevfltal
    rapkptlryftterflpllrmrlddpsgsnyvtamhrevfg