PDB entry 1fdq

View 1fdq on RCSB PDB site
Description: crystal structure of human brain fatty acid binding protein
Class: lipid binding protein
Keywords: omega-3, n-3, long chain poly unsaturated fatty acid, lipid binding protein
Deposited on 2000-07-20, released 2001-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fatty acid-binding protein, brain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fdqa_
  • Chain 'B':
    Compound: fatty acid-binding protein, brain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fdqb_
  • Heterogens: HXA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fdqA (A:)
veafcatwkltnsqnfdeymkalgvgfatrqvgnvtkptviisqegdkvvirtlstfknt
eisfqlgeefdettaddrncksvvsldgdklvhiqkwdgketnfvreikdgkmvmtltfg
dvvavrhyeka

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fdqB (B:)
veafcatwkltnsqnfdeymkalgvgfatrqvgnvtkptviisqegdkvvirtlstfknt
eisfqlgeefdettaddrncksvvsldgdklvhiqkwdgketnfvreikdgkmvmtltfg
dvvavrhyeka