PDB entry 1fdi

View 1fdi on RCSB PDB site
Description: oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite
Deposited on 1997-01-28, released 1997-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.192
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1fdi_ (-)
    mkkvvtvcpycasgckinlvvdngkivraeaaqgktnqgtlclkgyygwdfindtqiltp
    rlktpmirrqrggklepvswdealnyvaerlsaikekygpdaiqttgssrgtgnetnyvm
    qkfaravigtnnvdccarvxhgpsvaglhqsvgngamsnaineidntdlvfvfgynpads
    hpivanhvinakrngakiivcdprkietariadmhialkngsniallnamghviieenly
    dkafvasrtegfeeyrkivegytpesveditgvsaseirqaarmyaqaksaailwgmgvt
    qfyqgvetvrsltslamltgnlgkphagvnpvrgqnnvqgacdmgalpdtypgyqyvkdp
    anrekfakawgveslpahtgyriselphraahgevraayimgedplqtdaelsavrkafe
    dlelvivqdifmtktasaadvilpstswgehegvftaadrgfqrffkavepkwdlktdwq
    iiseiatrmgypmhynntqeiwdelrhlcpdfygatyekmgelgfiqwpcrdtsdadqgt
    sylfkekfdtpnglaqfftcdwvapidkltdeypmvlstvrevghyscrsmtgncaalaa
    ladepgyaqintedakrlgiedealvwvhsrkgkiitraqvsdrpnkgaiymtyqwwiga
    cnelvtenlspitktpeykycavrvepiadqraaeqyvideynklktrlreaala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fdi_ (-)
    mkkvvtvcpycasgckinlvvdngkivraeaaqgktnqgtlclkgyygwdfindtqiltp
    rlktpmirrqrggklepvswdealnyvaerlsaikekygpdaiqttgssrgtgnetnyvm
    qkfaravigtnnvdccarvhgpsvaglhqsvgngamsnaineidntdlvfvfgynpadsh
    pivanhvinakrngakiivcdprkietariadmhialkngsniallnamghviieenlyd
    kafvasrtegfeeyrkivegytpesveditgvsaseirqaarmyaqaksaailwgmgvtq
    fyqgvetvrsltslamltgnlgkphagvnpvrgqnnvqgacdmgalpdtypgyqyvkdpa
    nrekfakawgveslpahtgyriselphraahgevraayimgedplqtdaelsavrkafed
    lelvivqdifmtktasaadvilpstswgehegvftaadrgfqrffkavepkwdlktdwqi
    iseiatrmgypmhynntqeiwdelrhlcpdfygatyekmgelgfiqwpcrdtsdadqgts
    ylfkekfdtpnglaqfftcdwvapidkltdeypmvlstvrevghyscrsmtgncaalaal
    adepgyaqintedakrlgiedealvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigac
    nelvtenlspitktpeykycavrvepiadqraaeqyvideynklktrlreaala