PDB entry 1fdi

View 1fdi on RCSB PDB site
Description: oxidized form of formate dehydrogenase h from e. coli complexed with the inhibitor nitrite
Class: oxidoreductase
Keywords: oxidoreductase, selenium, selenocysteine, secys, molybdenum, molybdopterin, mpt, molybdopterin guanine dinucleotide, mgd, iron sulfur cluster, fe4s4, formate, dehydrogenase, anaerobic
Deposited on 1997-01-28, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.192
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formate dehydrogenase h
    Species: Escherichia coli [TaxId:562]
    Gene: FDHF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fdia1, d1fdia2
  • Heterogens: NO2, SF4, MGD, 6MO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fdiA (A:)
    mkkvvtvcpycasgckinlvvdngkivraeaaqgktnqgtlclkgyygwdfindtqiltp
    rlktpmirrqrggklepvswdealnyvaerlsaikekygpdaiqttgssrgtgnetnyvm
    qkfaravigtnnvdccarvahgpsvaglhqsvgngamsnaineidntdlvfvfgynpads
    hpivanhvinakrngakiivcdprkietariadmhialkngsniallnamghviieenly
    dkafvasrtegfeeyrkivegytpesveditgvsaseirqaarmyaqaksaailwgmgvt
    qfyqgvetvrsltslamltgnlgkphagvnpvrgqnnvqgacdmgalpdtypgyqyvkdp
    anrekfakawgveslpahtgyriselphraahgevraayimgedplqtdaelsavrkafe
    dlelvivqdifmtktasaadvilpstswgehegvftaadrgfqrffkavepkwdlktdwq
    iiseiatrmgypmhynntqeiwdelrhlcpdfygatyekmgelgfiqwpcrdtsdadqgt
    sylfkekfdtpnglaqfftcdwvapidkltdeypmvlstvrevghyscrsmtgncaalaa
    ladepgyaqintedakrlgiedealvwvhsrkgkiitraqvsdrpnkgaiymtyqwwiga
    cnelvtenlspitktpeykycavrvepiadqraaeqyvideynklktrlreaala