PDB entry 1fd8

View 1fd8 on RCSB PDB site
Description: solution structure of the cu(I) form of the yeast metallochaperone, atx1
Class: metal transport
Keywords: Metallochaperone, Atx1, HEAVY-METAL-ASSOCIATED DOMAIN, OXYGEN TOXICITY, metal transport
Deposited on 2000-07-20, released 2001-03-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: atx1 copper chaperone
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fd8a_
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fd8A (A:)
    maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki
    kktgkevrsgkql