PDB entry 1fd8

View 1fd8 on RCSB PDB site
Description: solution structure of the cu(i) form of the yeast metallochaperone, atx1
Deposited on 2000-07-20, released 2001-03-14
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-14, with a file datestamp of 2001-03-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fd8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fd8A (A:)
    maeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfileki
    kktgkevrsgkql