PDB entry 1fd6

View 1fd6 on RCSB PDB site
Description: delta0: a computationally designed core variant of the b1 domain of streptococcal protein g
Deposited on 2000-07-19, released 2001-09-19
The last revision prior to the SCOP 1.59 freeze date was dated 2001-09-19, with a file datestamp of 2001-09-19.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fd6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fd6A (A:)
    mttfkliingktlkgettteavdaataekvfkqyandngidgewtyddatktftvte