PDB entry 1fd3

View 1fd3 on RCSB PDB site
Description: human beta-defensin 2
Class: antimicrobial protein
Keywords: defensin, human beta-defensin 2, beta-defensin
Deposited on 2000-07-19, released 2000-11-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.16
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-defensin 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fd3a_
  • Chain 'B':
    Compound: beta-defensin 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fd3b_
  • Chain 'C':
    Compound: beta-defensin 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fd3c_
  • Chain 'D':
    Compound: beta-defensin 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fd3d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fd3A (A:)
    gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fd3B (B:)
    gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fd3B (B:)
    gigdpvtclksgaichpvfcprrykqigtcglpgtkcckk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fd3C (C:)
    gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fd3C (C:)
    gigdpvtclksgaichpvfcprrykqigtcglpgtkcckk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fd3D (D:)
    gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp