PDB entry 1fd3
View 1fd3 on RCSB PDB site
Description: human beta-defensin 2
Class: antimicrobial protein
Keywords: defensin, human beta-defensin 2, beta-defensin
Deposited on
2000-07-19, released
2000-11-01
The last revision prior to the SCOP 1.75 freeze date was dated
2003-04-01, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.16
AEROSPACI score: 0.78
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: beta-defensin 2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1fd3a_ - Chain 'B':
Compound: beta-defensin 2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1fd3b_ - Chain 'C':
Compound: beta-defensin 2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1fd3c_ - Chain 'D':
Compound: beta-defensin 2
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1fd3d_ - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1fd3A (A:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1fd3B (B:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp
Sequence, based on observed residues (ATOM records): (download)
>1fd3B (B:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckk
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1fd3C (C:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp
Sequence, based on observed residues (ATOM records): (download)
>1fd3C (C:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckk
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1fd3D (D:)
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp