PDB entry 1fd2

View 1fd2 on RCSB PDB site
Description: site-directed mutagenesis of azotobacter vinelandii ferredoxin i. (fe-s) cluster-driven protein rearrangement
Deposited on 1988-12-08, released 1989-10-15
The last revision prior to the SCOP 1.71 freeze date was dated 1992-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.232
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1fd2__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fd2_ (-)
    afvvtdncikckytdcvevapvdcfyegpnflvihpdecidcalcepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler