PDB entry 1fd1

View 1fd1 on RCSB PDB site
Description: structure of a 7*fe ferredoxin from azotobacter vinelandii
Deposited on 1981-01-14, released 1981-01-14
The last revision was dated 1981-01-14, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: FS4, FS3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1fd1_ (-)
afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcalcepecpaqaifsedev
pgdmqefiqlnaeladvwpnitekkdplpdaedwdgvkgklqhlerv

  • Chain 'p':
    No sequence available.