PDB entry 1fcy

View 1fcy on RCSB PDB site
Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the rarbeta/gamma-selective retinoid cd564
Deposited on 2000-07-19, released 2000-09-11
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-11, with a file datestamp of 2000-09-11.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.134
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fcya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fcyA (A:)
aspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle