PDB entry 1fcy

View 1fcy on RCSB PDB site
Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the rarbeta/gamma-selective retinoid cd564
Class: gene regulation
Keywords: isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold, Structural Proteomics in Europe, SPINE, Structural Genomics, GENE REGULATION
Deposited on 2000-07-19, released 2000-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: retinoic acid receptor gamma-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13631 (0-235)
    • conflict (0)
  Domains in SCOPe 2.08: d1fcya_
• Heterogens: 564, LMU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fcyA (A:)
  aspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
  vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
  agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
  rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle