PDB entry 1fcx

View 1fcx on RCSB PDB site
Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the rargamma-selective retinoid bms184394
Class: gene regulation
Keywords: isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold, Structural Proteomics in Europe, SPINE, Structural Genomics, GENE REGULATION
Deposited on 2000-07-19, released 2000-09-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.124
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: retinoic acid receptor gamma-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13631 (0-234)
  Domains in SCOPe 2.06: d1fcxa_
• Heterogens: 184, LMU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fcxA (A:)
  spqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciikiv
  efakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhna
  gfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepllealr
  lyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle