PDB entry 1fct

View 1fct on RCSB PDB site
Description: nmr structures of ferredoxin chloroplastic transit peptide from chlamydomonas reinhardtii promoted by trifluoroethanol in aqueous solution
Class: transit peptide
Keywords: transit peptide
Deposited on 1994-03-30, released 1994-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin chloroplastic transit peptide sequence from the green alga
  Species: Chlamydomonas reinhardtii [TaxId:3055]
  Gene: CDNA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07839 (0-31)
  Domains in SCOPe 2.08: d1fcta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fctA (A:)
  mamamrstfaarvgakpavrgarpasrmscma