PDB entry 1fcs

View 1fcs on RCSB PDB site
Description: crystal structure of a distal site double mutant of sperm whale myoglobin at 1.6 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1993-04-20, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: synthetic gene
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (1-153)
    • conflict (64)
    • conflict (67)
    • conflict (122)
  Domains in SCOPe 2.07: d1fcsa_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fcsA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkvgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg