PDB entry 1fcs

View 1fcs on RCSB PDB site
Description: crystal structure of a distal site double mutant of sperm whale myoglobin at 1.6 angstroms resolution
Deposited on 1993-04-20, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1fcs__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1fcs_ (-)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkvgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gnfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fcs_ (-)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkvgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg