PDB entry 1fcs

View 1fcs on RCSB PDB site
Description: crystal structure of a distal site double mutant of sperm whale myoglobin at 1.6 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1993-04-20, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: synthetic gene
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • conflict (64)
      • conflict (67)
      • conflict (122)
    Domains in SCOPe 2.08: d1fcsa_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcsA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkvgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg