PDB entry 1fcj

View 1fcj on RCSB PDB site
Description: crystal structure of oass complexed with chloride and sulfate
Deposited on 2000-07-18, released 2000-10-18
The last revision prior to the SCOP 1.59 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1fcja_
  • Chain 'B':
    Domains in SCOP 1.59: d1fcjb_
  • Chain 'C':
    Domains in SCOP 1.59: d1fcjc_
  • Chain 'D':
    Domains in SCOP 1.59: d1fcjd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcjA (A:)
    skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
    gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
    gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
    ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
    klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
    sg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcjB (B:)
    skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
    gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
    gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
    ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
    klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
    sger
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcjC (C:)
    skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
    gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
    gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
    ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
    klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
    sger
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcjD (D:)
    skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
    gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
    gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
    ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
    klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
    sg