PDB entry 1fch

View 1fch on RCSB PDB site
Description: crystal structure of the pts1 complexed to the tpr region of human pex5
Class: signaling protein
Keywords: protein-peptide complex, tetratricopeptide repeat, tpr, helical repeat, signaling protein
Deposited on 2000-07-18, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal targeting signal 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50542 (Start-367)
      • conflict (153)
    Domains in SCOPe 2.07: d1fcha_
  • Chain 'B':
    Compound: peroxisomal targeting signal 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50542 (Start-367)
      • conflict (153)
    Domains in SCOPe 2.07: d1fchb_
  • Chain 'C':
    Compound: pts1-containing peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1FCH (0-4)
  • Chain 'D':
    Compound: pts1-containing peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1FCH (0-4)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fchA (A:)
    meferaksaiesdvdfwdklqaeleemakrdaeahpwlsdyddltsatydkgyqfeeenp
    lrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqaeneqellaisa
    lrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvtpaeegaggag
    lgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcf
    taalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlga
    hreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstl
    ltmfglpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fchA (A:)
    satydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylg
    ttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpay
    ahlvtrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcf
    taalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlga
    hreavehflealnmqrksggamseniwstlrlalsmlgqsdaygaadardlstlltmfgl
    pq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fchB (B:)
    meferaksaiesdvdfwdklqaeleemakrdaeahpwlsdyddltsatydkgyqfeeenp
    lrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqaeneqellaisa
    lrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvtpaeegaggag
    lgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcf
    taalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlga
    hreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstl
    ltmfglpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fchB (B:)
    kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae
    neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvt
    prilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaal
    svrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahrea
    vehflealnmqrksgamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.