PDB entry 1fce

View 1fce on RCSB PDB site
Description: processive endocellulase celf of clostridium cellulolyticum
Class: cellulase degradation
Keywords: cellulase degradation, family 48, thiooligosaccharide inhibitor, processive endo action, hydrolase
Deposited on 1998-07-06, released 1999-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase celf
    Species: Clostridium cellulolyticum [TaxId:1521]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fcea_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fceA (A:)
    asspankvyqdrfesmyskikdpangyfseqgipyhsietlmveapdyghvttseamsyy
    mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
    ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
    qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
    wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
    awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
    qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
    rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
    nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
    veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
    qvptqrlhrfwaqsefavangvyailfpd