PDB entry 1fce

View 1fce on RCSB PDB site
Description: processive endocellulase celf of clostridium cellulolyticum
Deposited on 1998-07-06, released 1999-07-22
The last revision prior to the SCOP 1.67 freeze date was dated 1999-07-22, with a file datestamp of 1999-07-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1fce__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fce_ (-)
    asspankvyqdrfesmyskikdpangyfseqgipyhsietlmveapdyghvttseamsyy
    mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
    ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
    qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
    wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
    awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
    qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
    rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
    nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
    veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
    qvptqrlhrfwaqsefavangvyailfpd