PDB entry 1fcd

View 1fcd on RCSB PDB site
Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution
Deposited on 1994-08-18, released 1994-11-01
The last revision prior to the SCOP 1.57 freeze date was dated 1994-11-01, with a file datestamp of 1994-11-11.
Experiment type: -
Resolution: 2.53 Å
R-factor: 0.237
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcdA (A:)
    agrkvvvvgggtggataakyikladpsievtliepntdyytcylsneviggdrklesikh
    gydglrahgiqvvhdsatgidpdkklvktaggaefgydrcvvapgieliydkiegyseea
    aaklphawkageqtailrkqledmadggtvviappaapfrcppgpyerasqvayylkahk
    pmskviildssqtfskqsqfskgwerlygfgtenamiewhpgpdsavvkvdggemmveta
    fgdefkadvinlippqragkiaqiagltndagwcpvdiktfessihkgihvigdasianp
    mpksgysansqgkvaaaavvvllkgeepgtpsylntcysilapaygisvaaiyrpnadgs
    aiesvpdsggvtpvdapdwvlerevqyayswynnivhdtfg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcdB (B:)
    agrkvvvvgggtggataakyikladpsievtliepntdyytcylsneviggdrklesikh
    gydglrahgiqvvhdsatgidpdkklvktaggaefgydrcvvapgieliydkiegyseea
    aaklphawkageqtailrkqledmadggtvviappaapfrcppgpyerasqvayylkahk
    pmskviildssqtfskqsqfskgwerlygfgtenamiewhpgpdsavvkvdggemmveta
    fgdefkadvinlippqragkiaqiagltndagwcpvdiktfessihkgihvigdasianp
    mpksgysansqgkvaaaavvvllkgeepgtpsylntcysilapaygisvaaiyrpnadgs
    aiesvpdsggvtpvdapdwvlerevqyayswynnivhdtfg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcdC (C:)
    eptaemltnncagchgthgnsvgpaspsiaqmdpmvfvevmegfksgeiastimgriakg
    ystadfekmagyfkqqtyqpakqsfdtaladtgaklhdkycekchveggkpladeedyhi
    lagqwtpylqyamsdfreerrpmekkmasklrellkaegdagldalfafyasqq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fcdD (D:)
    eptaemltnncagchgthgnsvgpaspsiaqmdpmvfvevmegfksgeiastimgriakg
    ystadfekmagyfkqqtyqpakqsfdtaladtgaklhdkycekchveggkpladeedyhi
    lagqwtpylqyamsdfreerrpmekkmasklrellkaegdagldalfafyasqq