PDB entry 1fcc

View 1fcc on RCSB PDB site
Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg
Class: complex (antibody/antigen)
Keywords: complex (antibody/antigen)
Deposited on 1995-01-17, released 1995-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.289
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg1 mo61 fc
    Species: Homo sapiens [TaxId:9606]
    Gene: N-TERMINAL FRAGMENT OF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-205)
      • conflict (34)
      • conflict (45)
      • conflict (56)
      • conflict (74)
      • conflict (77)
      • conflict (118)
      • conflict (120)
    Domains in SCOPe 2.06: d1fcca1, d1fcca2
  • Chain 'B':
    Compound: igg1 mo61 fc
    Species: Homo sapiens [TaxId:9606]
    Gene: N-TERMINAL FRAGMENT OF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857 (0-205)
      • conflict (34)
      • conflict (45)
      • conflict (56)
      • conflict (74)
      • conflict (77)
      • conflict (118)
      • conflict (120)
    Domains in SCOPe 2.06: d1fccb1, d1fccb2
  • Chain 'C':
    Compound: streptococcal protein g (c2 fragment)
    Species: Streptococcus [TaxId:1301]
    Gene: N-TERMINAL FRAGMENT OF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fccc_
  • Chain 'D':
    Compound: streptococcal protein g (c2 fragment)
    Species: Streptococcus [TaxId:1301]
    Gene: N-TERMINAL FRAGMENT OF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fccd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fccA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fccB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fccC (C:)
    ttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fccD (D:)
    ttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte