PDB entry 1fcc

View 1fcc on RCSB PDB site
Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg
Deposited on 1995-01-17, released 1995-04-20
The last revision prior to the SCOP 1.61 freeze date was dated 1995-07-20, with a file datestamp of 1995-08-14.
Experiment type: -
Resolution: 3.5 Å
R-factor: 0.289
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fccA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fccC (C:)
    ttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte