PDB entry 1fcb

View 1fcb on RCSB PDB site
Description: molecular structure of flavocytochrome b2 at 2.4 angstroms resolution
Deposited on 1990-01-16, released 1991-01-15
The last revision prior to the SCOP 1.69 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fcbA (A:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fcbA (A:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsng
    asralskfidpsltwkdieelkkktklpivikgvqrtedvikaaeigvsgvvlsnhggrq
    ldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalclgakgvglgrpfly
    anscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlkartvgvpndvlyn
    evyegptltefeda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fcbB (B:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvtkvpqmistlascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fcbB (B:)
    getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
    ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
    vtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
    tvdapslgqrekdmklkfsnveesqgasralskfidpsltwkdieelkkktklpivikgv
    qrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdgg
    vrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsia
    elkpdlldlstlkartvgvpndvlynevyegptltefeda