PDB entry 1fc5

View 1fc5 on RCSB PDB site
Description: crystal structure of molybdopterin biosynthesis moea protein
Class: biosynthetic protein
Keywords: molybdopterin, four modules, with magnesium, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics
Deposited on 2000-07-17, released 2001-07-25
The last revision prior to the SCOP 1.73 freeze date was dated 2001-07-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.253
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdopterin biosynthesis moea protein
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281
      • modified residue (7)
      • modified residue (16)
      • modified residue (57)
      • modified residue (98)
      • modified residue (112)
      • modified residue (119)
      • modified residue (211)
    Domains in SCOP 1.73: d1fc5a1, d1fc5a2, d1fc5a3
  • Chain 'B':
    Compound: molybdopterin biosynthesis moea protein
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12281
      • modified residue (7)
      • modified residue (16)
      • modified residue (57)
      • modified residue (98)
      • modified residue (112)
      • modified residue (119)
      • modified residue (211)
    Domains in SCOP 1.73: d1fc5b1, d1fc5b2, d1fc5b3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fc5A (A:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fc5A (A:)
    tglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavr
    ladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngv
    rftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfs
    tgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqa
    dvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsa
    tltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevt
    ttghqgshifssfslgncfivlerdrgnvevgewvevepfnalf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fc5B (B:)
    mefttglmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdg
    yavrladiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqm
    dngvrftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrv
    alfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafiea
    dsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgn
    pvsatltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadge
    levtttghqgshifssfslgncfivlerdrgnvevgewvevepfnalfggl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fc5B (B:)
    glmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrl
    adiasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvr
    ftaevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirkvrvalfst
    gdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraafieadsqad
    vvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcglpgnpvsat
    ltfyqlvqpllaklsgntasglparqrvrtasrlkktpgrldfqrgvlqrnadgelevtt
    tghqgshifssfslgncfivlerdrgnvevgewvevepfnalf