PDB entry 1fc4

View 1fc4 on RCSB PDB site
Description: 2-amino-3-ketobutyrate coa ligase
Class: transferase
Keywords: 2-amino-3-ketobutyrate CoA ligase, pyridoxal phosphate, coenzyme A, TRANSFERASE, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI
Deposited on 2000-07-17, released 2001-05-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.151
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-3-ketobutyrate conenzyme a ligase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07912 (3-400)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (71)
      • modified residue (78)
      • modified residue (104)
      • modified residue (160)
      • modified residue (188)
      • modified residue (210)
      • modified residue (234)
      • modified residue (293)
      • modified residue (315)
      • modified residue (333)
      • modified residue (373)
    Domains in SCOPe 2.06: d1fc4a1, d1fc4a2
  • Chain 'B':
    Compound: 2-amino-3-ketobutyrate conenzyme a ligase
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07912 (3-400)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (71)
      • modified residue (78)
      • modified residue (104)
      • modified residue (160)
      • modified residue (188)
      • modified residue (210)
      • modified residue (234)
      • modified residue (293)
      • modified residue (315)
      • modified residue (333)
      • modified residue (373)
    Domains in SCOPe 2.06: d1fc4b1, d1fc4b2
  • Heterogens: AKB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fc4A (A:)
    gshmrgefyqqltndletaraeglfkeeriitsaqqaditvadgshvinfcannylglan
    hpdliaaakagmdshgfgmasvrficgtqdshkeleqklaaflgmedailysscfdangg
    lfetllgaedaiisdalnhasiidgvrlckakryryanndmqelearlkeareagarhvl
    iatdgvfsmdgvianlkgvcdladkydalvmvddshavgfvgengrgsheycdvmgrvdi
    itgtlgkalggasggytaarkevvewlrqrsrpylfsnslapaivaasikvlemveagse
    lrdrlwanarqfreqmsaagftlagadhaiipvmlgdavvaqkfarelqkegiyvtgffy
    pvvpkgqarirtqmsaahtpeqitraveaftrigkqlgvia
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fc4B (B:)
    gshmrgefyqqltndletaraeglfkeeriitsaqqaditvadgshvinfcannylglan
    hpdliaaakagmdshgfgmasvrficgtqdshkeleqklaaflgmedailysscfdangg
    lfetllgaedaiisdalnhasiidgvrlckakryryanndmqelearlkeareagarhvl
    iatdgvfsmdgvianlkgvcdladkydalvmvddshavgfvgengrgsheycdvmgrvdi
    itgtlgkalggasggytaarkevvewlrqrsrpylfsnslapaivaasikvlemveagse
    lrdrlwanarqfreqmsaagftlagadhaiipvmlgdavvaqkfarelqkegiyvtgffy
    pvvpkgqarirtqmsaahtpeqitraveaftrigkqlgvia