PDB entry 1fc2

View 1fc2 on RCSB PDB site
Description:
Deposited on 1981-05-21, released 1981-10-02
The last revision prior to the SCOP 1.55 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fc2c_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fc2d1, d1fc2d2

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fc2C (C:)
    fnkeqqnafyeilhlpnlneeqrngfiqslkddpsqsanllaea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fc2D (D:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls