PDB entry 1fc1

View 1fc1 on RCSB PDB site
Description: crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1981-05-21, released 1981-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fc fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (49)
      • conflict (60)
      • conflict (71)
      • conflict (89)
      • conflict (92)
      • conflict (133)
      • conflict (135)
    Domains in SCOPe 2.06: d1fc1a1, d1fc1a2
  • Chain 'B':
    Compound: fc fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • conflict (49)
      • conflict (60)
      • conflict (71)
      • conflict (89)
      • conflict (92)
      • conflict (133)
      • conflict (135)
    Domains in SCOPe 2.06: d1fc1b1, d1fc1b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fc1A (A:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgv
    qvhnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq
    prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fc1A (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fc1B (B:)
    thtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgv
    qvhnaktkpreqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgq
    prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
    sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fc1B (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
    styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlppsree
    mtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls