PDB entry 1fc0

View 1fc0 on RCSB PDB site
Description: human liver glycogen phosphorylase complexed with n-acetyl-beta-d-glucopyranosylamine
Class: transferase
Keywords: phosphorylated protein, allosteric, glucose analog, inhibitor, TRANSFERASE
Deposited on 2000-07-17, released 2000-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fc0a_
  • Chain 'B':
    Compound: Glycogen phosphorylase, liver form
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fc0b_
  • Heterogens: NBG, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fc0A (A:)
    akpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvr
    dhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldie
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveead
    dwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvnt
    mrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdieklp
    wskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfpk
    dvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkfq
    nktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkqe
    nklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvp
    rtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipat
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddvaa
    ldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeay
    vkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsnes
    nkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fc0A (A:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapgdyiqavldrnla
    enisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskftvfdafpdqvaiqlnd
    thpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprh
    leiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakih
    sdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqlt
    klhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqlln
    clhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsk
    lkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvem
    aeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfk
    diinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtike
    yaqniwnvepsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fc0B (B:)
    akpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtvr
    dhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldie
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveead
    dwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvnt
    mrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdieklp
    wskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfpk
    dvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkfq
    nktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkqe
    nklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfvp
    rtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipat
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddvaa
    ldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyeay
    vkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsnes
    nkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fc0B (B:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapgdyiqavldrnla
    enisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgtvfdafpdqvaiqln
    dthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllpr
    hleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvaki
    hsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsql
    tklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqll
    nclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgs
    klkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganve
    maeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlf
    kdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtik
    eyaqniwnvepsd