PDB entry 1fbz
View 1fbz on RCSB PDB site
Description: Structure-based design of a novel, osteoclast-selective, nonpeptide Src SH2 inhibitor with in vivo anti-resorptive activity
Class: transferase
Keywords: sh2 domain, nonpeptide inhibitor, transferase
Deposited on
2000-07-17, released
2000-08-23
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.23
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Proto-oncogene tyrosine-protein kinase LCK
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1fbza_ - Chain 'B':
Compound: Proto-oncogene tyrosine-protein kinase LCK
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1fbzb_ - Heterogens: CC1, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1fbzA (A:)
epepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1fbzB (B:)
epepwffknlsrkdaerqllapgnthgsfliresestagsfclsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt