PDB entry 1fbv

View 1fbv on RCSB PDB site
Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases
Deposited on 2000-07-17, released 2000-08-30
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-30, with a file datestamp of 2000-08-30.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.227
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbvA (A:)
    ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm
    etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk
    gifpsglfqgdtfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalks
    tidltcndyisvfefdiftrlfqpwssllrnwnslavthpgymafltydevkarlqkfih
    kpgsyifrlsctrlgqwaigyvtadgnilqtiphnkplfqalidgfregfylfpdgrnqn
    pdltglceptpqdhikvtqeqyelycemgstfqlckicaendkdvkiepcghlmctsclt
    swqesegqgcpfcrceikgtepivvdpf
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fbvC (C:)
    srrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaeypf
    kppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehplra
    dlaeeyskdrkkfcknaeeftkky